DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and AT2G38610

DIOPT Version :9

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_181395.1 Gene:AT2G38610 / 818443 AraportID:AT2G38610 Length:286 Species:Arabidopsis thaliana


Alignment Length:298 Identity:72/298 - (24%)
Similarity:128/298 - (42%) Gaps:68/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VSGGTSNGEHENEHNANADGEKAQPAPAVQKYMQELMTERSRME---NHFPLAVKLIDEALERV- 105
            :||..:|..:.:...|.:...::.|.....:|:.||:.|..::.   ...|:..:|:::.:.|| 
plant     1 MSGLYNNSSYFSPARAASPQIRSTPEIDSSQYLTELLAEHQKLTPFMQVLPICSRLLNQEMFRVS 65

  Fly   106 ------------QLNGRIPTRDQYADVY---------------QQR------------------- 124
                        :|..|.|:....:::.               |:|                   
plant    66 GMMSNQGFGDFDRLRHRSPSPMASSNLMSNVSNTGLGGWNGLSQERLSGTPGMTMDWQGAPGSPS 130

  Fly   125 --TIKLSQKVHVPIKD-KKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAREEELRNS 186
              |:|...::.:|:.: ..||:||:||||:||||:|::..|.|::.|.|:.|:||..:|::||..
plant   131 SYTVKRILRLEIPVDNYPNFNFVGRLLGPRGNSLKRVEATTGCRVFIRGKGSIKDPEKEDKLRGR 195

  Fly   187 ADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIRRYLTP--DKHDDIRQEQYRELMEDPEAA 249
            ..  |.|||..||:.:....|.:....|:..|...|...|.|  :..|.|:::|.|||       
plant   196 PG--YEHLNEQLHILIEADLPASIVEIRLRQAQEIIEELLKPVDESQDFIKRQQLREL------- 251

  Fly   250 KKLTLRQLQQQSNAAASGAGGGGGGGGGNGNGGAAGSG 287
            ..|....|:::|    .|..|||.....|.:|....:|
plant   252 ALLNSNNLREES----PGPSGGGSVSPFNSSGKRPKTG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 42/117 (36%)
AT2G38610NP_181395.1 STAR_dimer 29..75 CDD:406848 8/45 (18%)
KH-I 135..235 CDD:412160 36/101 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.