DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and qki2

DIOPT Version :9

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_021335713.1 Gene:qki2 / 393815 ZFINID:ZDB-GENE-040426-1462 Length:341 Species:Danio rerio


Alignment Length:217 Identity:64/217 - (29%)
Similarity:108/217 - (49%) Gaps:48/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GEHENEHNANADGEKAQPAPAVQKYMQELMTERSRME---------NHFPLAVKLIDEALERVQL 107
            ||.|.:       ||.:|.|   .|:.:||.::..|.         ||..   :|:||.:.||: 
Zfish     3 GEMETK-------EKPKPTP---DYLMQLMNDKKLMSSLPNFCGIFNHLE---RLLDEEIGRVR- 53

  Fly   108 NGRIPTRDQYADVYQQRTIK--------------LSQKVHVPIKD-KKFNYVGKLLGPKGNSLRR 157
                  :|.|.|.....|.|              |.:|::||:|: ..||:||::|||:|.:.::
Zfish    54 ------KDMYNDTLNGSTDKRTSELPDAVGPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQ 112

  Fly   158 LQEETQCKIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEI 222
            |:.||.|||::.|:.||:|:.:||:  |.....:.|||..|||.::.......|..::..|:.|:
Zfish   113 LEAETGCKIMVRGKGSMRDKKKEEQ--NRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEV 175

  Fly   223 RRYLTP--DKHDDIRQEQYREL 242
            ::.|.|  :..|.:::.|..||
Zfish   176 KKLLVPAAEGEDSLKKMQLMEL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 40/117 (34%)
qki2XP_021335713.1 STAR_dimer 10..68 CDD:318695 18/70 (26%)
SF1_like-KH 83..205 CDD:239088 40/117 (34%)
PRK00708 139..299 CDD:331498 15/59 (25%)
Quaking_NLS 314..341 CDD:293159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590087
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.