DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and CG3927

DIOPT Version :9

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster


Alignment Length:195 Identity:115/195 - (58%)
Similarity:145/195 - (74%) Gaps:4/195 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NADGEKAQPA--PAVQKYMQELMTERSRMENHFPLAVKLIDEALERVQLNGRIPTRDQYADVYQQ 123
            |.|....||.  ...||::.:|..||.|:...|||...||||:::||...||||.::.:||||||
  Fly    12 NQDQPTYQPRLNEVAQKFLADLDAERKRLSAEFPLCALLIDESVDRVYSTGRIPGKEPFADVYQQ 76

  Fly   124 RTIKLSQKVHVPI-KDKKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAREEELRNSA 187
            :.:|:.|||.||: |..|||:.||:|||||||||||||||.|||||.||.||:||.:|||||:|.
  Fly    77 KPMKIIQKVFVPVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRDRNKEEELRSSG 141

  Fly   188 DAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIRRYLTPDKHDDIRQEQYRELME-DPEAAKK 251
            |.:||||:..|.:|||.:|||||.|||:||||||||:||.||.:||:..||.||||| :|::|||
  Fly   142 DPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMNPKSAKK 206

  Fly   252  251
              Fly   207  206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 79/115 (69%)
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 81/117 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468737
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.