DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and qkr58E-3

DIOPT Version :9

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster


Alignment Length:374 Identity:138/374 - (36%)
Similarity:186/374 - (49%) Gaps:84/374 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 HENEHNANADGEKAQPAPAVQKYMQELMTERSRMENHFPLAVKLIDEALERVQLNGRIPTRDQYA 118
            |:::...|         ...||::.:|..||.|:...|||...|||||::||...||||.::.||
  Fly    15 HDHQPRLN---------EVAQKFLADLDEERQRLSADFPLCALLIDEAVDRVYCTGRIPGKEFYA 70

  Fly   119 DVYQQRTIKLSQKVHVPIKD-KKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAREEE 182
            |||:|:.:|::|||.||:|. .|||:.||:|||||||||||||||||||.|.||.|::||.:||:
  Fly    71 DVYKQKPMKITQKVFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRDRNKEEQ 135

  Fly   183 LRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIRRYLTPDKHDDIRQEQYRELME-DP 246
            ||::.|.:||||...|.:||||:|.|||.|||:||||||||:||.|||:|::..||.||||| ||
  Fly   136 LRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYLIPDKNDEVSHEQLRELMEMDP 200

  Fly   247 EAAKKLTLRQLQQQSNAAASGAGGGGGGGGGNGNGGAAGSGSNNGNGNQRSGGNYRQKFQQQSHY 311
            |:||.:....|:...:......||                   |.||..:.....::..:.....
  Fly   201 ESAKNIHGPNLEAYRSVFDKKFGG-------------------NSNGAPKYINLIKRAAENPPEV 246

  Fly   312 RHNEETVYFRSHNNAYHQPKPYVPAAQRGNAMHTTLPPQAIVRASPPGMVVSAASFNGRNAGLGN 376
            ...||..|...|.                      :||    :..|.|...|..           
  Fly   247 DDVEEVAYEYEHR----------------------MPP----KRPPTGYEYSKP----------- 274

  Fly   377 AGGGGIMANSIVATTGGGIGGAVPPNMR---------YRPAAPYQFVKK 416
                   ..||:.|.........|.:|:         |:| .||..:||
  Fly   275 -------RPSIIPTNAAAYKRPYPTDMKRMREPPIKSYKP-NPYTILKK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 76/115 (66%)
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 78/118 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468736
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.