DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and F54D1.1

DIOPT Version :9

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_502114.1 Gene:F54D1.1 / 186227 WormBaseID:WBGene00010046 Length:278 Species:Caenorhabditis elegans


Alignment Length:247 Identity:63/247 - (25%)
Similarity:105/247 - (42%) Gaps:43/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GTGVVPTGVSGGTSNGEHENEHNANADGEKAQPAPAVQKYMQELMTERSRMENHFPLAVKLIDEA 101
            |.|.:..|.....:..:..:.|:||: |..|.|.|:           |..:.|| .|:......:
 Worm    49 GQGFIDNGYGSDYNKNDFYSPHSANS-GYSASPFPS-----------RPSLPNH-ALSTSFYHNS 100

  Fly   102 LERVQLNGRIPTRDQYADVYQQRTIK-----LSQKVHVPI-------KDKKFNYVGKLLGPKGNS 154
            ......|||:.:.||....:.:..|.     |..||::|.       |..|.||:|::|||.|.|
 Worm   101 FMTPIRNGRMRSPDQDLGDWSREKINDTQHVLQTKVYIPEPPVSIDGKKVKCNYIGRILGPSGMS 165

  Fly   155 LRRLQEETQCKIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYAL 219
            .|.::.:....::|.|..|::::|.:|.:|.    :..||..||||.:............:....
 Worm   166 ARMIENQYDVTLLIRGAGSVRNKAMDERVRK----RNEHLEEPLHVLLIARHNDKTKCEEILNKA 226

  Fly   220 AE-IRRYLTPDKHDDIRQEQ---YREL----MEDPEAAKKLTLRQLQQQSNA 263
            || |...||| .||:.:.:|   |.::    .|.|:...     ||.:||::
 Worm   227 AEKIESLLTP-IHDEYKMDQLVSYAKMNGTYQERPKRKS-----QLDEQSHS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 36/129 (28%)
F54D1.1NP_502114.1 SF1_like-KH 133..257 CDD:239088 36/128 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.