DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and K07H8.9

DIOPT Version :9

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_501390.1 Gene:K07H8.9 / 177620 WormBaseID:WBGene00019509 Length:254 Species:Caenorhabditis elegans


Alignment Length:225 Identity:57/225 - (25%)
Similarity:109/225 - (48%) Gaps:43/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EHENEHNANADGEKAQPAPAVQKYMQELMTERSRM----ENHFPLAVKLIDEALERVQLN----- 108
            ::|.:..:....|::.....|..|.:.|:.|:||:    :.:|  :|.||||.:.|:.:.     
 Worm    21 DYERDPKSIQIHEESDQMDVVISYFKLLLAEKSRLLQYGQANF--SVHLIDEEIGRLFMAPISMA 83

  Fly   109 --------GRIPTRDQYADV------------YQQRTIKLSQKVHVPIKD-KKFNYVGKLLGPKG 152
                    ||...|  :.|:            ..:..:.|::.:.:|::. ..:|::|:::||:|
 Worm    84 DIGILEECGREALR--FTDLGAMFSDSDDSMHSDEDEVTLTESIRIPVETYPTYNFIGRIIGPRG 146

  Fly   153 NSLRRLQEETQCKIVILGRFSMK---DRAREEELRNSADAKYAHLNLPLHVEVSTIAPPAEAYAR 214
            .:.::|:::|.|:|:|.|..|.|   :...:.....|.||    ::|||.|.|.|..|..||.||
 Worm   147 TTAKQLEKDTGCRIMIRGNHSNKMYGNALHKTHGDGSQDA----IDLPLRVIVETSGPRREATAR 207

  Fly   215 VAYALAEIRRYLT--PDKHDDIRQEQYREL 242
            :..||..::..|.  ||..|::::.|..||
 Worm   208 ITAALETVQVLLVPPPDGRDELKRRQLVEL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 37/120 (31%)
K07H8.9NP_501390.1 SF1_like-KH 122..245 CDD:239088 37/120 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.