DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and Y69A2AR.32

DIOPT Version :9

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_741340.2 Gene:Y69A2AR.32 / 177042 WormBaseID:WBGene00022101 Length:384 Species:Caenorhabditis elegans


Alignment Length:205 Identity:57/205 - (27%)
Similarity:101/205 - (49%) Gaps:40/205 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ADGEKAQPAPAVQKYMQ-----ELMTERSRMENHFPLAVKLIDEALERV---------QLNGRIP 112
            |..:|.|.:...||..|     ||.|           .::||.:|:|..         :|...:.
 Worm     2 ASNKKNQASGGDQKLAQSESGVELKT-----------LLQLIGKAIEAAPATDEPAEPELPRFMR 55

  Fly   113 TRDQYADVYQQRTIKLSQKVHVPI-KDKKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKD 176
            ..|.|.|..:|..:.||:.:.||: |..|:|:||::|||:|.::::|::||.|:|.:.||.| ..
 Worm    56 NNDNYHDQRRQFVVTLSEILMVPVEKYPKYNFVGRILGPRGMTVKQLEKETGCRIFVRGRAS-TT 119

  Fly   177 RAREEELRNSADAKYAHLNL-----------PLHVEVSTIAPPAEAYARVAYALAEIRRYLTP-- 228
            .:..|...|.:...::..:|           ||||.:......:.|.|::|:|:..|:|.|:|  
 Worm   120 ASNPESKPNKSTPSFSKPSLSIISRNALTEEPLHVYIECQDTQSAAQAKMAHAVEVIQRLLSPPK 184

  Fly   229 DKHDDIRQEQ 238
            |..|:::::|
 Worm   185 DGKDELKRQQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 38/124 (31%)
Y69A2AR.32NP_741340.2 SF1_like-KH 72..206 CDD:239088 38/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.