DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and Khdrbs3

DIOPT Version :9

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_034288.2 Gene:Khdrbs3 / 13992 MGIID:1313312 Length:346 Species:Mus musculus


Alignment Length:293 Identity:115/293 - (39%)
Similarity:161/293 - (54%) Gaps:37/293 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QKYMQELMTERSRMENHFPLAVKLIDEALERVQLNGRIPTRDQYADVYQQRTIKLSQKVHVPIKD 138
            :||:.|||.|:..::..|..|::|::..:|:.| .|.....::|.||...:.:||.|||.:|:|.
Mouse     3 EKYLPELMAEKDSLDPSFTHALRLVNREIEKFQ-KGEGKEEEKYIDVVINKNMKLGQKVLIPVKQ 66

  Fly   139 -KKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHVEV 202
             .|||:|||||||:||||:||||||..|:.|||:.||:|:|:|||||.|.:|||.|||..|||.:
Mouse    67 FPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLI 131

  Fly   203 STIAPPAEAYARVAYALAEIRRYLTPDKHDDIRQEQYREL---------MEDPEAAKKLTLRQLQ 258
            ...|||||||||:.:||.||:::|.||.:|:|||.|.:||         .:.|....|.|||...
Mouse   132 EVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSENADVPVVRGKSTLRTRG 196

  Fly   259 QQSNAAASGAGG--------GGGGGGGNGNGGAAGSGS-NNGNG--NQRSGG----NYR------ 302
            ..:.|...|.||        |...|.....|..:..|. :.|.|  ..|:.|    .||      
Mouse   197 VTTPAITRGRGGVTARPVAVGVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPP 261

  Fly   303 -QKFQQQSHYRHNEETVY----FRSHNNAYHQP 330
             |:...:..|.....|.|    :.|::|:|..|
Mouse   262 TQETYGEYDYDDGYGTAYDEQSYDSYDNSYSTP 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 71/124 (57%)
Khdrbs3NP_034288.2 Involved in homodimerization. /evidence=ECO:0000250|UniProtKB:O75525 1..160 81/157 (52%)
Qua1 5..53 CDD:292891 14/48 (29%)
SF1_like-KH 58..177 CDD:239088 71/118 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..266 11/53 (21%)
Sam68-YY 266..320 CDD:293176 7/29 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845514
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8696
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.