DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and khdrbs3

DIOPT Version :9

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_009296555.1 Gene:khdrbs3 / 101867535 ZFINID:ZDB-GENE-130530-892 Length:305 Species:Danio rerio


Alignment Length:283 Identity:96/283 - (33%)
Similarity:121/283 - (42%) Gaps:112/283 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 KFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHVEVST 204
            :||:|||||||:||||:||||:|..|:.|||:.||:|:.:|||||.|.:.||.|||..|||.:..
Zfish    33 QFNFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKEKEEELRKSGETKYHHLNEDLHVLIEV 97

  Fly   205 IAPPAEAYARVAYALAEIRRYLTPDKHDDIRQEQYREL------MED---PEAAKKLTLRQLQQQ 260
            .|||||||||:.:||.||:::|.||.:|:|||.|.:||      .||   |.|..|.|.|     
Zfish    98 FAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSEDAKVPAARGKTTTR----- 157

  Fly   261 SNAAASGAGGGGGGGGGNGNGGAAGSGSNNGNGNQRSGGNYRQKFQQQSHYRHNEETVYFRSHNN 325
                              |.|.:|       .|..|:.|.                         
Zfish   158 ------------------GRGTSA-------PGTHRTRGG------------------------- 172

  Fly   326 AYHQPKPYVPAAQRGNAMHTTLPPQAIV------RASPPGMVVSAASFNGRNAGLGNAGGGGIMA 384
                    ||            ||||.|      |.:||..|.|:..                  
Zfish   173 --------VP------------PPQAAVPRGAAPRGAPPSRVPSSRG------------------ 199

  Fly   385 NSIVATTGGGIGGAVPPNMRYRP 407
               ||.:.....|| ||...|||
Zfish   200 ---VAVSSRRARGA-PPPPGYRP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 62/109 (57%)
khdrbs3XP_009296555.1 SF1_like-KH 34..141 CDD:239088 62/106 (58%)
Sam68-YY 227..279 CDD:293176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.