DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and qkib

DIOPT Version :9

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_021336383.1 Gene:qkib / 100462714 ZFINID:ZDB-GENE-081028-54 Length:176 Species:Danio rerio


Alignment Length:195 Identity:57/195 - (29%)
Similarity:97/195 - (49%) Gaps:46/195 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GEHENEHNANADGEKAQPAPAVQKYMQELMTERSRME---------NHFPLAVKLIDEALERVQL 107
            ||.|.:       ||.:|.|   .|:.:||.::..|.         ||..   :|:||.:.||: 
Zfish     3 GEMETK-------EKPKPTP---DYLMQLMNDKKLMSSLPNFCGIFNHLE---RLLDEEISRVR- 53

  Fly   108 NGRIPTRDQYADVYQQRT--------------IKLSQKVHVPIKD-KKFNYVGKLLGPKGNSLRR 157
                  :|.|.|.....|              ::|.:|::||:|: ..||:||::|||:|.:.::
Zfish    54 ------KDMYNDTLNGSTEKRSSELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQ 112

  Fly   158 LQEETQCKIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEI 222
            |:.||.|||::.|:.||:|:.:||:  |.....:.|||..|||.::.......|..::..|:.|:
Zfish   113 LEAETGCKIMVRGKGSMRDKKKEEQ--NRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEV 175

  Fly   223  222
            Zfish   176  175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 34/95 (36%)
qkibXP_021336383.1 STAR_dimer 10..68 CDD:318695 18/70 (26%)
SF1_like-KH 83..>175 CDD:239088 33/93 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.