DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and AT1G09660

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001320903.1 Gene:AT1G09660 / 837494 AraportID:AT1G09660 Length:298 Species:Arabidopsis thaliana


Alignment Length:168 Identity:52/168 - (30%)
Similarity:85/168 - (50%) Gaps:29/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 IPKPEIYANVYSEKPIRVAQKVLFPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSM 160
            :|.|.|.     :|.||:.    .|:.:||.:||||:||||:||:|::::..|.|::.:.||.|:
plant   139 LPNPPIV-----KKVIRLD----VPVDKYPSYNFVGRILGPRGNSLKRVELATHCRVFIRGRGSV 194

  Fly   161 RDHGKEEELRSSGNPKYAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKFMIP--DANDDIRLE 223
            :|..|||:|:  |.|.|.||...|||.|....|......|:.:|:..:...:.|  ::.|..:.|
plant   195 KDTVKEEKLK--GKPGYEHLCEPLHVLIEAELPEDIINSRLEHAVHFLESLLKPMDESMDHYKRE 257

  Fly   224 QLREMDGKERMYKKSHHYSKSYGDHGAYSSRTPPPASS 261
            ||:|:...                :|.....:|.|:.|
plant   258 QLKELAAL----------------NGTLREESPSPSLS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 39/100 (39%)
AT1G09660NP_001320903.1 STAR_dimer 45..90 CDD:406848
KH-I 146..246 CDD:412160 39/105 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.