DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and AT4G26480

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001320071.1 Gene:AT4G26480 / 828754 AraportID:AT4G26480 Length:308 Species:Arabidopsis thaliana


Alignment Length:250 Identity:65/250 - (26%)
Similarity:109/250 - (43%) Gaps:63/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 APETPEADGGGHTTSHAALRDTPQLNEKTNAYLQECLLEKKTLEK-----KHIITKRLLDDEVEK 89
            ||::|...||        ||..|....:...||.|.|.|:..|..     .|:.  ||::.|:.:
plant    38 APQSPNFSGG--------LRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHVC--RLMNQEILR 92

  Fly    90 I------------------LVSGRI------------------------PKPEIYANVYSEKPIR 112
            :                  |.||.|                        |.|....:..|...:.
plant    93 VTTLLENALSQSRFDHPSPLASGGIFQNSRADMNGWASQFPSERSVSSSPAPNWLNSPGSSSGLI 157

  Fly   113 VAQ--KVLFPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNP 175
            |.:  :|..|:.:||.:||||::|||:||:|::::..|.|::::.||.|::|..||:.:|  |.|
plant   158 VKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEDMMR--GKP 220

  Fly   176 KYAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKFMIP--DANDDIRLEQLREM 228
            .|.||:..||:.:....|......|:..|...:...:.|  :.:|..:.:||||:
plant   221 GYEHLNEPLHILVEAELPIEIVDARLMQAREILDDLLTPVEETHDFYKKQQLREL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 34/102 (33%)
AT4G26480NP_001320071.1 STAR_dimer 61..>93 CDD:406848 10/33 (30%)
KH-I 159..259 CDD:412160 33/101 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.