DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and AT4G26480

DIOPT Version :10

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_194378.2 Gene:AT4G26480 / 828754 AraportID:AT4G26480 Length:308 Species:Arabidopsis thaliana


Alignment Length:118 Identity:28/118 - (23%)
Similarity:48/118 - (40%) Gaps:23/118 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RQMKRLAVL------PYNLQVKDPDPDVLAKVVAIAKKTGDYASLSLVDLQVIALTYELETIHVG 99
            ||.:..::|      |:.|...||..|.......:....|  .|..|.||.:.::.:.:|.:   
plant    94 RQSQETSLLHTHRGIPHQLSGLDPRRDYRRHEDLLHGPHG--LSSGLGDLPLHSIPHGIEDV--- 153

  Fly   100 RDHLRDEPLPSITVAAATKPDAFGGTQLLKGFYVPTKKSQSADESQEDDGENI 152
             .|:.|   |||.:     ||.   |.:.||....:|.:.:|..|...:.:|:
plant   154 -SHIED---PSINI-----PDQ---TVIKKGPVSLSKSNNNAVSSLSLNKDNL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I_KHDRBS 109..210 CDD:411812 12/44 (27%)
AT4G26480NP_194378.2 STAR_dimer 61..>93 CDD:435414
KH-I 159..259 CDD:469614 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.