DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and AT2G38610

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_181395.1 Gene:AT2G38610 / 818443 AraportID:AT2G38610 Length:286 Species:Arabidopsis thaliana


Alignment Length:296 Identity:74/296 - (25%)
Similarity:127/296 - (42%) Gaps:81/296 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PAATGAPETPEADGGGHTTSHAALRDTPQLNEKTNAYLQECLLEKKTLE---KKHIITKRLLDDE 86
            ||...:|:               :|.||:::  ::.||.|.|.|.:.|.   :...|..|||:.|
plant    13 PARAASPQ---------------IRSTPEID--SSQYLTELLAEHQKLTPFMQVLPICSRLLNQE 60

  Fly    87 VEKILVSG---------------RIPKPEIYANVYSE---------------------------- 108
            :.:  |||               |.|.|...:|:.|.                            
plant    61 MFR--VSGMMSNQGFGDFDRLRHRSPSPMASSNLMSNVSNTGLGGWNGLSQERLSGTPGMTMDWQ 123

  Fly   109 ----KP----IRVAQKVLFPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGK 165
                .|    ::...::..|:..||.|||||::|||:||:|::::..|.|::.:.|:.|::|..|
plant   124 GAPGSPSSYTVKRILRLEIPVDNYPNFNFVGRLLGPRGNSLKRVEATTGCRVFIRGKGSIKDPEK 188

  Fly   166 EEELRSSGNPKYAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKFMIP--DANDDIRLEQLREM 228
            |::||  |.|.|.||:..||:.|....|.:....|:..|...|.:.:.|  ::.|.|:.:||||:
plant   189 EDKLR--GRPGYEHLNEQLHILIEADLPASIVEIRLRQAQEIIEELLKPVDESQDFIKRQQLREL 251

  Fly   229 DGKERMYKKSHHYSKSYGDHGAYSSRTPPPASSKPK 264
                .:...::...:|.|..|..|......:..:||
plant   252 ----ALLNSNNLREESPGPSGGGSVSPFNSSGKRPK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 36/104 (35%)
AT2G38610NP_181395.1 STAR_dimer 29..75 CDD:406848 14/47 (30%)
KH-I 135..235 CDD:412160 35/101 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.