DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and khdrbs2

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001072215.1 Gene:khdrbs2 / 779662 XenbaseID:XB-GENE-490722 Length:345 Species:Xenopus tropicalis


Alignment Length:372 Identity:126/372 - (33%)
Similarity:184/372 - (49%) Gaps:75/372 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YLQECLLEKKTLEKKHIITKRLLDDEVEKILVS--GRIPKPEIYANVYSEKPIRVAQKVLFPIKE 123
            ||.|.:.||.:|:...:...||||:|:.|...|  .:....:.|.::.|.|.|:::::||.|:|:
 Frog     6 YLPELMAEKDSLDPSFVHAMRLLDEEIVKFQDSEGNKEDGEKKYLDIISNKNIKLSERVLIPVKQ 70

  Fly   124 YPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLSRDLHVEI 188
            |||||||||:|||:||:|::|||||..||.::|:.||||..||||||.|...|:||||.:|||.:
 Frog    71 YPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKIKEEELRKSDEAKHAHLSDELHVLL 135

  Fly   189 STVAPPAEAYHRISYALGEIRKFMIPDANDDIRLEQLREM------DGKER-------------- 233
            ...|||.|||.|:|:||.||:||::||.||:||.|||||:      |..||              
 Frog   136 EVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSDDSERGKGTRGRGIRVPST 200

  Fly   234 -MYKKSHHYSKSYGDHGAYSSRTPPPASSKPKVYSILE-----KARYVMDDPNYGIVKTHRSRDH 292
             ...:....|.::...||.::|..|  .::..:.::..     :|:.....|.|.:         
 Frog   201 PSRNRGGVISPAFPGRGASATRGAP--ITRGTISTVARGIPTPRAKAAPTTPGYRL--------- 254

  Fly   293 ELYDHHGEYDRYATPPPQTSKHSTHHAQYDSSSYERDYRREYHPHSSSSSYAAAYPAKPSNGRSS 357
                          |||.|.:      .||...|:..:..:| ...|...|...|   .|..:|.
 Frog   255 --------------PPPLTIE------TYDDYGYDDGFGEDY-DEQSYDIYENNY---NSQTQSV 295

  Fly   358 SSYRPTTSGSGSHSSAHY--ETGSRSRESVR----------YRSAPY 392
            |.|.....|:...|..||  |..|:||.:::          ||..||
 Frog   296 SEYYDYEHGTNEESYNHYEQEEWSKSRSTLKAPLQRPARAGYREHPY 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 60/100 (60%)
khdrbs2NP_001072215.1 Qua1 5..57 CDD:374463 15/50 (30%)
SF1_like-KH 61..180 CDD:239088 71/118 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..224 7/45 (16%)
Sam68-YY 263..317 CDD:374636 15/57 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..345 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I3883
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9347
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.