DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and khdrbs1

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001017045.1 Gene:khdrbs1 / 549799 XenbaseID:XB-GENE-479347 Length:360 Species:Xenopus tropicalis


Alignment Length:389 Identity:123/389 - (31%)
Similarity:172/389 - (44%) Gaps:85/389 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EKTNAYLQECLLEKKTLEKKHIITKRLLDDEVEKILVSGRIPKPE--IYANVYSEKPIRVAQKVL 118
            |....||.|.:.||.:|:........||..|:|::...|...|.|  .|.:::|.|.:::.:::|
 Frog     2 ETETKYLPELMAEKDSLDPSFTHAMSLLGKEIERLKKGGDAKKDEEDTYLDLFSHKNMKLKERIL 66

  Fly   119 FPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLSRD 183
            .|:|.|||||||||||||:|||:::|||||..|:.|:|:.||||..||||||..|:|||:||:.|
 Frog    67 IPVKLYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYSHLNMD 131

  Fly   184 LHVEISTVAPPAEAYHRISYALGEIRKFMIP---------DANDDIRLEQLREMDGKERMYKKSH 239
            |||.|....||.|:|.|:::|:.|::||::|         |..|||..||..|:.     |....
 Frog   132 LHVFIEVFGPPCESYTRMAHAMEEVKKFLVPLTPESFSYQDMMDDICQEQFMELS-----YLNGA 191

  Fly   240 HYSKSYGDHGAYSSR---TPPPA---SSKPKVYSILEKARYVMDDPNYGIVKTHRSRDH------ 292
            ...:|.|......||   .||||   ||:.:...:  :.......|..|.:....|...      
 Frog   192 PPEQSRGGTRGGPSRGRGGPPPAAAPSSRGRAGPL--RPLVPRGAPGRGAISRGASVSRPVPPSS 254

  Fly   293 -------------------------ELYDHHGEYDRYATPPPQTSKHSTHHAQYDSSSYERDYRR 332
                                     |.||.:|..|.||.|     .:..:...|..|..|.:| .
 Frog   255 ASRGAPAGRARGAAIQRISLPPPAPETYDEYGYEDSYAEP-----SYEGYEGYYSQSQGETEY-Y 313

  Fly   333 EYHPHSSSSSYAAAYPAKPSNGRSSS----SYRPTTSGSGSHSSAHYETGSRSRESVRYRSAPY 392
            :|.......|| .:|.....||...|    |.||...|:                   ||..||
 Frog   314 DYGHGEGPESY-ESYGQDNWNGSRPSLKVPSSRPLKGGA-------------------YREHPY 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 56/100 (56%)
khdrbs1NP_001017045.1 Qua1 6..58 CDD:406639 15/51 (29%)
KH-I 57..162 CDD:412160 58/104 (56%)
Sam68-YY 282..331 CDD:406871 15/55 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I3883
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9347
Panther 1 1.100 - - O PTHR11208
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.