DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and nsr

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster


Alignment Length:332 Identity:124/332 - (37%)
Similarity:183/332 - (55%) Gaps:61/332 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PQLNEKTNAYLQECLLEKKTLEKKHIITKRLLDDEVEKILVSGRIPKPEIYANVYSEKPIRVAQK 116
            |:|||....:|.:...|:|.|..:..:...|:|:.|:::..:||||..|.||:||.::|:::.||
  Fly    25 PRLNEVAQKFLADLDEERKRLSAEFPLCALLIDESVDRVFSTGRIPGKEFYADVYHQRPMKITQK 89

  Fly   117 VLFPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLS 181
            |..|:.::|||||..||||||||::|:|:|||.||:|:.||:||||..|||||||||:|:||||.
  Fly    90 VFVPVNKFPKFNFARKILGPKGNSVRRLKEETNCKIVIKGRSSMRDRNKEEELRSSGDPRYAHLH 154

  Fly   182 RDLHVEISTVAPPAEAYHRISYALGEIRKFMIPDANDDIRLEQLRE-MDGKERMYKKSHHYS--- 242
            :||.:|:|.||||||.|.||:|||.||||::|||.|||:..||.|| |:......|||:..:   
  Fly   155 KDLFLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMNPESAKKSNGLNMAP 219

  Fly   243 -KSYGDHGAYSSRTPPP--------ASSKPKVYSILEKARYVMDD-------PNYGIVKTHRSRD 291
             :|..|.....:|...|        .:..|:..:.:|:..|..|:       |:.|.        
  Fly   220 YRSIFDKTIGGNRNGAPKYNNQIRRVTENPREVADMEEVEYDYDEHRMPPSRPSLGF-------- 276

  Fly   292 HELYDHHGEYDRYATPPP-QTSKHSTHHAQYDSSSYERDYRREYHPHSSSSSYAAAYPAKPSNGR 355
                       .|:.||| .|:.::|            .::|.| |:.:..:.....|.|     
  Fly   277 -----------EYSKPPPSMTATNAT------------PFKRAY-PYPTDMNRTREPPIK----- 312

  Fly   356 SSSSYRP 362
               ||:|
  Fly   313 ---SYKP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 64/100 (64%)
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 76/118 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468744
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.