DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and CG10384

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster


Alignment Length:330 Identity:108/330 - (32%)
Similarity:154/330 - (46%) Gaps:84/330 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 NVYSEKPIRVAQKVLFPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEE 168
            ::..:||::||.||..|::::||||||||:||||||::::|||:|||||.|:||.||||..||||
  Fly    25 DITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSMRDRRKEEE 89

  Fly   169 LRSSGNPKYAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKFMIPDANDDIRLEQLREMDGKER 233
            ||.||:.:||||..||||||||.|.||||:.||:|||.|:|:|::||.:||||.||:.||.....
  Fly    90 LRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRFLVPDYHDDIRQEQMWEMQALTS 154

  Fly   234 MYKKSHHYSKSYGDHGAYSSRTPPPASSKP----------------------------------- 263
                    :.:.|.|....|.:|...||..                                   
  Fly   155 --------TPALGAHSLEDSHSPTINSSSQVGGTTNSSSNGASGRGLGGGLADMDTSNDDKSDDA 211

  Fly   264 ---KVYSILEKARYVMDDPNYGI-----VKTHRSRDHELYDHHGEYDRYATPPPQTSKHSTHHA- 319
               :..|.::|........:.||     :.|........:.||          .|..:|..||| 
  Fly   212 SGMECLSAVDKLDCSSSCASLGISGITTISTTSPEHPHPHQHH----------QQHQQHQQHHAH 266

  Fly   320 -----------QYDSSSYERDYRREYH-----PHSSSSSYAAAYPAKPSNGRSSSSYRPTTSGSG 368
                       |.....:...::..:|     .|..:|:.|||.      |...|......:.:.
  Fly   267 LHPAHAHGNQQQQQQVQHHHSHQAHFHQLLQQAHGGASAAAAAC------GEHLSGQTTPATAAA 325

  Fly   369 SHSSA 373
            .|::|
  Fly   326 LHTTA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 67/100 (67%)
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 72/118 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468752
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.