DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and qkia

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_571299.1 Gene:qkia / 30471 ZFINID:ZDB-GENE-990415-230 Length:383 Species:Danio rerio


Alignment Length:312 Identity:89/312 - (28%)
Similarity:146/312 - (46%) Gaps:73/312 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YLQECLLEKKTLEK--------KHIITKRLLDDEVEKI-------LVSGRIPK-----PEIYANV 105
            ||.:.|.|||.:..        .|:  :||||:|:.::       .|:|.:.|     ||....:
Zfish    18 YLMQLLNEKKLMTSLPNLCGIFTHL--ERLLDEEINRVRKDMYNDSVNGLVDKHPLELPEPVGPI 80

  Fly   106 YSEKPIRVAQKVLFPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELR 170
                 :.:.:|:..|:||||.:||||:||||:|.|.:||:.||.||::|.||:||||..|||:.|
Zfish    81 -----VHLQEKLFVPVKEYPDYNFVGRILGPRGLTAKQLEAETGCKIMVRGRSSMRDKKKEEQNR 140

  Fly   171 SSGNPKYAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKFMIP--DANDDIRLEQLREMDGKER 233
              |.|.:.||:.||||.|:.......|..::..|:.|::|.::|  :..|:::..||.|:.....
Zfish   141 --GKPNWEHLNEDLHVLITVEDTQTRAEIKMRRAVEEVKKLLVPAAEGEDNLKKMQLMELAILNG 203

  Fly   234 MYKKSH------HYSKSYGDHGAYSSR---TP-----PPASSKP------KVYSILEKAR----- 273
            .|:.::      .:|.:.....|...|   .|     |||:.:|      .:.:|:...:     
Zfish   204 TYRDTNIKAPTLAFSLAAAAAAAQGPRLIAAPPGQVLPPATLRPPTPAGTPIMNIIRPTQMATVL 268

  Fly   274 ------YVMDDPNYGIVKTHRSRDHELYDHHGEYDRYATPPPQTSKHSTHHA 319
                  .|...|:.||:.|      ..||:     .||..|....::...|:
Zfish   269 PNGTPTLVPPTPDAGIIYT------TPYDY-----PYALAPTSLLEYPIEHS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 45/100 (45%)
qkiaNP_571299.1 STAR_dimer 11..69 CDD:293152 14/52 (27%)
SF1_like-KH 84..206 CDD:239088 51/123 (41%)
Quaking_NLS 356..383 CDD:293159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590106
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.