DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and KHDRBS2

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_016865823.1 Gene:KHDRBS2 / 202559 HGNCID:18114 Length:413 Species:Homo sapiens


Alignment Length:337 Identity:124/337 - (36%)
Similarity:170/337 - (50%) Gaps:62/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YLQECLLEKKTLEKKHIITKRLLDDEVEKILVSGRIPKPE----IYANVYSEKPIRVAQKVLFPI 121
            ||.|.:.||.:|:...:...|||.:|:||.  .|...|.|    .|.:|.|.|.|:::::||.|:
Human     6 YLPELMAEKDSLDPSFVHASRLLAEEIEKF--QGSDGKKEDEEKKYLDVISNKNIKLSERVLIPV 68

  Fly   122 KEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLSRDLHV 186
            |:|||||||||:|||:||:|::|||||..||.::|:.||||..||||||.||..||||||.:|||
Human    69 KQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHV 133

  Fly   187 EISTVAPPAEAYHRISYALGEIRKFMIPDANDDIRLEQLREM--------DGKERMYK-KSHHYS 242
            .|...|||.|||.|:|:||.||:||::||.||:||.|||||:        .|:.|..: :....:
Human   134 LIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRIA 198

  Fly   243 KSYGDHGAYSSRTPPPASSK----PKVYSILEKARYVMDDPNYGIVKTHRSRDHELYDHHGEYDR 303
            .:....|...:..|||...:    |:..::...|..|  .|....|.|.|:|...      ....
Human   199 PTAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPV--PPVARGVPTPRARGAP------TVPG 255

  Fly   304 YATPPPQTSKHSTHHAQYDSSSYERDYRREYHPHSSSSSYAAAYPAKPSNGRSSSSYRPTTSGSG 368
            |..|||..      |..|:.                       ||:.|     .|.:..|.:.|.
Human   256 YRAPPPPA------HEAYEE-----------------------YPSLP-----LSLFFDTVAKSH 286

  Fly   369 SHSSAHY-ETGS 379
            .|..... :|||
Human   287 QHCDNEVPQTGS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 63/100 (63%)
KHDRBS2XP_016865823.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3875
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8456
orthoMCL 1 0.900 - - OOG6_110429
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.