DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and Qk

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001152989.1 Gene:Qk / 19317 MGIID:97837 Length:341 Species:Mus musculus


Alignment Length:320 Identity:88/320 - (27%)
Similarity:145/320 - (45%) Gaps:83/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DTPQLNEKTNAYLQECLLEKKTLEK--------KHIITKRLLDDEVEKILVSGRIPKPEIY---A 103
            :|.:..:.|..||.:.:.:||.:..        .|:  :||||:|:.::       :.::|   .
Mouse     6 ETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHL--ERLLDEEISRV-------RKDMYNDTL 61

  Fly   104 NVYSEK----------PI-RVAQKVLFPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGR 157
            |..:||          || ::.:|:..|:||||.|||||:||||:|.|.:||:.||.||::|.|:
Mouse    62 NGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGK 126

  Fly   158 NSMRDHGKEEELRSSGNPKYAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKFMIP--DANDDI 220
            .||||..|||:.|  |.|.:.||:.||||.|:.......|..::..|:.|::|.::|  :..|.:
Mouse   127 GSMRDKKKEEQNR--GKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSL 189

  Fly   221 RLEQLREMDGKERMYKKSHHYSKSYGDHGAYSS-------------------RTPPPASSKPKVY 266
            :..||.|:......|:.::..|.:.....|.::                   |||.||.  |.:.
Mouse   190 KKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAG--PTIM 252

  Fly   267 SILEK--------------ARYVMDDPNYGIVKTHRSRDHELYDHHGEYDRYATPPPQTS 312
            .::.:              |..|...|..|::.|             .|:...|..|.||
Mouse   253 PLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYT-------------PYEYPYTLAPATS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 48/111 (43%)
QkNP_001152989.1 STAR_dimer 10..66 CDD:406848 13/64 (20%)
Qua1 domain, involved in homodimerization. /evidence=ECO:0000250|UniProtKB:Q17339 11..82 17/79 (22%)
KH-I_Hqk 81..183 CDD:411893 47/103 (46%)
Qua2 domain, involved in RNA binding. /evidence=ECO:0000250|UniProtKB:Q96PU8 182..213 6/30 (20%)
PHA03247 <211..314 CDD:223021 18/104 (17%)
SH3-binding 276..279 0/2 (0%)
Quaking_NLS 312..341 CDD:406855
Nuclear localization signal 324..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1833
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.