DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and asd-2

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001250340.1 Gene:asd-2 / 188703 WormBaseID:WBGene00006423 Length:486 Species:Caenorhabditis elegans


Alignment Length:243 Identity:81/243 - (33%)
Similarity:119/243 - (48%) Gaps:59/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AATGAPE-----------------------TPEADGGGHTTSHAALRDTPQLNEKTNAYLQECLL 67
            |:|.||:                       ||.....|.:||        |..:.:..||.:.|.
 Worm    52 ASTSAPQSPTLLAPPISLQDVMTHASTDLLTPNGSANGVSTS--------QQQQYSAEYLSQLLK 108

  Fly    68 EKKTLEK-----KHIITKRLLDDEVEKILV----------SGRIPKPEIYANVYSEKPIRVAQKV 117
            :||.|..     .|:  :||.|:|:.|:.|          |..:|..|..:.|::|       ||
 Worm   109 DKKQLAAFPNVFHHL--ERLADEEINKVRVVLFQCEFSKESAPLPDAEGDSTVHTE-------KV 164

  Fly   118 LFPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLSR 182
            ..|.||:|.:||||:||||:|.|.:||::||.||::|.||.||||..|||..|  |.|.:.|||.
 Worm   165 FVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNR--GKPNWEHLSE 227

  Fly   183 DLHVEISTVAPPAEAYHRISYALGEIRKFMI--PDANDDIRLEQLREM 228
            :|||.|........|..::..|:.|:||.::  |:..||::.:||.|:
 Worm   228 ELHVLIQCEDTENRAKVKLMRAVEEVRKLLVPAPEGEDDLKRKQLMEL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 45/100 (45%)
asd-2NP_001250340.1 STAR_dimer 95..145 CDD:374616 13/51 (25%)
SF1_like-KH 161..283 CDD:239088 54/124 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1833
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.