DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and F54D1.1

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_502114.1 Gene:F54D1.1 / 186227 WormBaseID:WBGene00010046 Length:278 Species:Caenorhabditis elegans


Alignment Length:263 Identity:57/263 - (21%)
Similarity:111/263 - (42%) Gaps:60/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRDYNEDAADYKRKRRDEEPAATGAPETPEADGGGHTTS--HAALRDTPQLNEKTNAYLQEC-- 65
            |..|||::.. |.....:...:|:..|..|.......:||  |.:.. ||..|.:..:..|:.  
 Worm    57 YGSDYNKNDF-YSPHSANSGYSASPFPSRPSLPNHALSTSFYHNSFM-TPIRNGRMRSPDQDLGD 119

  Fly    66 LLEKKTLEKKHIITKRLLDDEVEKILVSGRIPKPEIYANVYSEKPIRVAQKVLFPIKEYPKFNFV 130
            ...:|..:.:|::..::.            ||:|          |:.:..|.:       |.|::
 Worm   120 WSREKINDTQHVLQTKVY------------IPEP----------PVSIDGKKV-------KCNYI 155

  Fly   131 GKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLSRDLHVEISTVAPPA 195
            |:||||.|.:.|.::.:....:::.|..|:|:...:|.:|.    :..||...|||.:.      
 Worm   156 GRILGPSGMSARMIENQYDVTLLIRGAGSVRNKAMDERVRK----RNEHLEEPLHVLLI------ 210

  Fly   196 EAYHR--------ISYALGEIRKFMIPDANDDIRLEQL---REMDG--KERMYKKSHHYSKSYGD 247
             |.|.        ::.|..:|...:.| .:|:.:::||   .:|:|  :||..:||....:|:.:
 Worm   211 -ARHNDKTKCEEILNKAAEKIESLLTP-IHDEYKMDQLVSYAKMNGTYQERPKRKSQLDEQSHSN 273

  Fly   248 HGA 250
            :.|
 Worm   274 YWA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 25/108 (23%)
F54D1.1NP_502114.1 SF1_like-KH 133..257 CDD:239088 34/164 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.