DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and K07H8.9

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_501390.1 Gene:K07H8.9 / 177620 WormBaseID:WBGene00019509 Length:254 Species:Caenorhabditis elegans


Alignment Length:224 Identity:50/224 - (22%)
Similarity:106/224 - (47%) Gaps:44/224 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QLNEKTN------AYLQECLLEKKTLEK--KHIITKRLLDDEVEKILVSGRIPKPEIYANV---- 105
            |::|:::      :|.:..|.||..|.:  :...:..|:|:|:.::.::     |...|::    
 Worm    30 QIHEESDQMDVVISYFKLLLAEKSRLLQYGQANFSVHLIDEEIGRLFMA-----PISMADIGILE 89

  Fly   106 ------------------------YSEKPIRVAQKVLFPIKEYPKFNFVGKILGPKGNTLRQLQE 146
                                    ..|..:.:.:.:..|::.||.:||:|:|:||:|.|.:||::
 Worm    90 ECGREALRFTDLGAMFSDSDDSMHSDEDEVTLTESIRIPVETYPTYNFIGRIIGPRGTTAKQLEK 154

  Fly   147 ETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKF 211
            :|.|::::.|.:|.:.:|.... ::.|:.....:...|.|.:.|..|..||..||:.||..::..
 Worm   155 DTGCRIMIRGNHSNKMYGNALH-KTHGDGSQDAIDLPLRVIVETSGPRREATARITAALETVQVL 218

  Fly   212 MI--PDANDDIRLEQLREMDGKERMYKKS 238
            ::  ||..|:::..||.|:......|:.|
 Worm   219 LVPPPDGRDELKRRQLVELAIMNGTYRPS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 29/100 (29%)
K07H8.9NP_501390.1 SF1_like-KH 122..245 CDD:239088 35/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.