DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and Y69A2AR.32

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_741340.2 Gene:Y69A2AR.32 / 177042 WormBaseID:WBGene00022101 Length:384 Species:Caenorhabditis elegans


Alignment Length:301 Identity:66/301 - (21%)
Similarity:128/301 - (42%) Gaps:71/301 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LEKKTLEKKHIITKRLLDDEVEKILVSGRIPKPEI---------YANVYSEKPIRVAQKVLFPIK 122
            :|.|||       .:|:...:|....:....:||:         |.:...:..:.:::.::.|::
 Worm    23 VELKTL-------LQLIGKAIEAAPATDEPAEPELPRFMRNNDNYHDQRRQFVVTLSEILMVPVE 80

  Fly   123 EYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSS----GNPKYAHLSRD 183
            :|||:||||:||||:|.|::||::||.|::.|.||.|......|.:...|    ..|..:.:||:
 Worm    81 KYPKYNFVGRILGPRGMTVKQLEKETGCRIFVRGRASTTASNPESKPNKSTPSFSKPSLSIISRN 145

  Fly   184 ------LHVEISTVAPPAEAYHRISYALGEIRKFMIP--DANDDIRLEQLREMDGKERMYKKSHH 240
                  |||.|......:.|..::::|:..|::.:.|  |..|:::.:||.::.    :...::.
 Worm   146 ALTEEPLHVYIECQDTQSAAQAKMAHAVEVIQRLLSPPKDGKDELKRQQLVDIS----LINGTYR 206

  Fly   241 YSKSYGDHGAYSSRTPPPASSKPKVYSILEKARYVMDDPNYGIVKTHRSRDHEL--YDHHGEYDR 303
            .:.:..:|.....|                        |.|....|..|.|.:|  .|.||.|..
 Worm   207 VTSTSNEHVGQFRR------------------------PRYSADPTSNSTDLQLRPLDAHGAYGD 247

  Fly   304 YATPPPQTSKHSTHHAQYDSSSYERDYRREYHPHSSSSSYA 344
            ..             :.|..:..:|.:::...|.::|..:|
 Worm   248 VG-------------SVYGIAQQKRIWQKPRGPDATSEEFA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 35/110 (32%)
Y69A2AR.32NP_741340.2 SF1_like-KH 72..206 CDD:239088 40/137 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.