DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and gld-1

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_492143.1 Gene:gld-1 / 172532 WormBaseID:WBGene00001595 Length:463 Species:Caenorhabditis elegans


Alignment Length:184 Identity:65/184 - (35%)
Similarity:105/184 - (57%) Gaps:18/184 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EKTNAYLQECLLEKKTLEK-KHIIT--KRLLDDEVEKILVS------GRIPKPEIYANVYSEKPI 111
            |.|..||.:.:.|||.|.. .|:.:  :||||||:.::.|:      .|:..||...::     |
 Worm   144 EATVEYLADLVKEKKHLTLFPHMFSNVERLLDDEIGRVRVALFQTEFPRVELPEPAGDM-----I 203

  Fly   112 RVAQKVLFPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNPK 176
            .:.:|:..|..|||.:||||:||||:|.|.:||:::|.||::|.|:.||||..||...|...|  
 Worm   204 SITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKAN-- 266

  Fly   177 YAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKFMI--PDANDDIRLEQLREM 228
            :.||..||||.:.........:.::..||.:::|.:|  |:..|:::.:||.|:
 Worm   267 WEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLIPAPEGTDELKRKQLMEL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 39/100 (39%)
gld-1NP_492143.1 STAR_dimer 144..190 CDD:293152 16/45 (36%)
SF1_like-KH 206..328 CDD:239088 45/117 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.