DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-1 and khdrbs3

DIOPT Version :9

Sequence 1:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_002932263.1 Gene:khdrbs3 / 100379996 XenbaseID:XB-GENE-941483 Length:342 Species:Xenopus tropicalis


Alignment Length:395 Identity:132/395 - (33%)
Similarity:182/395 - (46%) Gaps:118/395 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YLQECLLEKKTLEKKHIITKRLLDDEVEKILVSGRIPKPEIYANVYSEKPIRVAQKVLFPIKEYP 125
            ||.:.|.||..|:.......|::.:|:|| |..|.....:.|.:|...|.:::|||||.|||::|
 Frog     4 YLPQLLAEKDALDPSFTHALRMVKEEIEK-LQKGEDNTEDQYIDVVINKNMKLAQKVLIPIKQFP 67

  Fly   126 KFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLSRDLHVEIST 190
            |||||||:|||:||:|::|||:|:.||.::|:.||||..||||||.||..||.||:.||||.|..
 Frog    68 KFNFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKAKEEELRKSGEAKYYHLNDDLHVLIEV 132

  Fly   191 VAPPAEAYHRISYALGEIRKFMIPDANDDIRLEQLREMDGKERMYKKSHHYSKSYGDHGAYSSRT 255
            .|||||||.|:.:||.||:||:|||.||:||..||:|:               :|.:.|..::..
 Frog   133 FAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQEL---------------TYLNGGPETTEA 182

  Fly   256 P-------------------------PPAS-------------SKPKVYSILEKARYVMDDPNYG 282
            |                         |||.             :..:|.|  .:||        |
 Frog   183 PVVRGKPSIRARGVPVPALPRGRGGVPPAPTGVPRGAPAPRGVTPARVSS--ARAR--------G 237

  Fly   283 IVKTHRSR----------DHELYDHHGEY---DRYATPPPQTSKHSTHHAQYDSSSYERDYRREY 334
            :|.| |:|          ...:.|.:|||   |.|.|             .||..||: .|...|
 Frog   238 LVAT-RARGIPPPAGYRPPPPVQDTYGEYDYDDGYGT-------------AYDEQSYD-SYDNNY 287

  Fly   335 HPHSSSSSYAAAYPAKPSNGRSSSSYRPTTSGSG--SHSSAHYETGSRSRESV--------RYRS 389
            :                |.|:|::.|.....|.|  |:.|...|..:.||...        .||.
 Frog   288 N----------------SQGQSTADYYDYGHGLGEDSYDSYGQEDWANSRHKAPPARACKGTYRE 336

  Fly   390 APYPK 394
            .||.:
 Frog   337 QPYAR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 63/100 (63%)
khdrbs3XP_002932263.1 Qua1 3..52 CDD:374463 14/48 (29%)
SF1_like-KH 57..176 CDD:239088 74/133 (56%)
PHA03381 <193..>233 CDD:177618 5/41 (12%)
Sam68-YY 262..316 CDD:374636 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4780
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9347
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.