powered by:
Protein Alignment Mes4 and SPCC16C4.22
DIOPT Version :9
Sequence 1: | NP_001163253.1 |
Gene: | Mes4 / 37560 |
FlyBaseID: | FBgn0034726 |
Length: | 155 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001343092.1 |
Gene: | SPCC16C4.22 / 9406966 |
PomBaseID: | SPCC16C4.22 |
Length: | 87 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 74 |
Identity: | 27/74 - (36%) |
Similarity: | 44/74 - (59%) |
Gaps: | 0/74 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 TQLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAI 140
|.|||:|::.|:|.|.|:|..:|.:..:::.|.|||:..|:.|:|......|:|.|:.|||:..:
pombe 8 TVLPLSRVKRIIKQDEDVHYCSNASALLISVATELFVEKLATEAYQLAKLQKRKGIRYRDVEDVV 72
Fly 141 SAVDSLLFL 149
...|...||
pombe 73 RKDDQFEFL 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
54 |
1.000 |
Domainoid score |
I3249 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5208 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005115 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto101650 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_106333 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10252 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4325 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
9 | 8.800 |
|
Return to query results.
Submit another query.