DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes4 and SPCC16C4.22

DIOPT Version :9

Sequence 1:NP_001163253.1 Gene:Mes4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001343092.1 Gene:SPCC16C4.22 / 9406966 PomBaseID:SPCC16C4.22 Length:87 Species:Schizosaccharomyces pombe


Alignment Length:74 Identity:27/74 - (36%)
Similarity:44/74 - (59%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TQLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAI 140
            |.|||:|::.|:|.|.|:|..:|.:..:::.|.|||:..|:.|:|......|:|.|:.|||:..:
pombe     8 TVLPLSRVKRIIKQDEDVHYCSNASALLISVATELFVEKLATEAYQLAKLQKRKGIRYRDVEDVV 72

  Fly   141 SAVDSLLFL 149
            ...|...||
pombe    73 RKDDQFEFL 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes4NP_001163253.1 CBFD_NFYB_HMF 78..140 CDD:366318 23/61 (38%)
SPCC16C4.22NP_001343092.1 BUR6 <10..>86 CDD:333362 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3249
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005115
OrthoInspector 1 1.000 - - oto101650
orthoMCL 1 0.900 - - OOG6_106333
Panther 1 1.100 - - O PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.800

Return to query results.
Submit another query.