Sequence 1: | NP_001163253.1 | Gene: | Mes4 / 37560 | FlyBaseID: | FBgn0034726 | Length: | 155 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_015003.1 | Gene: | HAP5 / 854540 | SGDID: | S000005885 | Length: | 242 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 195 | Identity: | 49/195 - (25%) |
---|---|---|---|
Similarity: | 78/195 - (40%) | Gaps: | 56/195 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 EFSEEQDLEHQQAMETEEAELAETEEPLEITE----------------------ESPDNPEAEST 52
Fly 53 TEQLTE--------KPVTNG-----------------NKAPADNEA--------KMTQLPLARIR 84
Fly 85 NIMKLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAISAVDSLLFL 149
Fly 150 149 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mes4 | NP_001163253.1 | CBFD_NFYB_HMF | 78..140 | CDD:366318 | 26/61 (43%) |
HAP5 | NP_015003.1 | HAP5 | 1..>242 | CDD:227533 | 49/195 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5208 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4325 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |