DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes4 and HAP5

DIOPT Version :9

Sequence 1:NP_001163253.1 Gene:Mes4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_015003.1 Gene:HAP5 / 854540 SGDID:S000005885 Length:242 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:49/195 - (25%)
Similarity:78/195 - (40%) Gaps:56/195 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EFSEEQDLEHQQAMETEEAELAETEEPLEITE----------------------ESPDNPEAEST 52
            ::||:|.|:..:. |.|...|..:||...:.:                      |..||..::..
Yeast    38 QYSEQQQLQENEG-EGENTRLPVSEEEFRMVQELQAIQAGHDQANLPPSGRGSLEGEDNGNSDGA 101

  Fly    53 TEQLTE--------KPVTNG-----------------NKAPADNEA--------KMTQLPLARIR 84
            ..::.|        :.|..|                 |:..:.||.        |...||.||||
Yeast   102 DGEMDEDDEEYDVFRNVGQGLVGHYKEIMIRYWQELINEIESTNEPGSEHQDDFKSHSLPFARIR 166

  Fly    85 NIMKLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAISAVDSLLFL 149
            .:||.|.|:.|.:.||..|.|||.|:||..|:..::....::|::|:||.|:..|:...|...||
Yeast   167 KVMKTDEDVKMISAEAPIIFAKACEIFITELTMRAWCVAERNKRRTLQKADIAEALQKSDMFDFL 231

  Fly   150  149
            Yeast   232  231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes4NP_001163253.1 CBFD_NFYB_HMF 78..140 CDD:366318 26/61 (43%)
HAP5NP_015003.1 HAP5 1..>242 CDD:227533 49/195 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.