DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes4 and NF-YC2

DIOPT Version :9

Sequence 1:NP_001163253.1 Gene:Mes4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001077726.1 Gene:NF-YC2 / 842070 AraportID:AT1G56170 Length:199 Species:Arabidopsis thaliana


Alignment Length:131 Identity:42/131 - (32%)
Similarity:63/131 - (48%) Gaps:28/131 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 HQQAMETEEAELAETEEPLEITEESPDNPEAESTTEQLTEKPVTNGNKAPADNEAKMTQLPLARI 83
            |.|..:.::.::....:..||          |.||                  :.|...||||||
plant    46 HHQQQQQQQLQMFWANQMQEI----------EHTT------------------DFKNHTLPLARI 82

  Fly    84 RNIMKLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAISAVDSLLF 148
            :.|||.|.|:.|.:.||..|.|||.|:||..|:..::.:|.::|::|:||.|:..|||..|...|
plant    83 KKIMKADEDVRMISAEAPVIFAKACEMFILELTLRAWIHTEENKRRTLQKNDIAAAISRTDVFDF 147

  Fly   149 L 149
            |
plant   148 L 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes4NP_001163253.1 CBFD_NFYB_HMF 78..140 CDD:366318 28/61 (46%)
NF-YC2NP_001077726.1 HAP5 <58..>157 CDD:227533 40/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.