DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes4 and NF-YC5

DIOPT Version :9

Sequence 1:NP_001163253.1 Gene:Mes4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_199860.1 Gene:NF-YC5 / 835117 AraportID:AT5G50490 Length:186 Species:Arabidopsis thaliana


Alignment Length:94 Identity:32/94 - (34%)
Similarity:50/94 - (53%) Gaps:15/94 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NGNKAPADNE---------------AKMTQLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELFI 112
            |..:.|.|||               .|..:.|::||:.|||.|||:.|...||..:::||.|:|:
plant     7 NHQQPPKDNEQLKSFWSKGMEGDLNVKNHEFPISRIKRIMKFDPDVSMIAAEAPNLLSKACEMFV 71

  Fly   113 ASLSRESYTYTAQSKKKTIQKRDVDMAIS 141
            ..|:..|:.:..:|.:.||:|.|||..:|
plant    72 MDLTMRSWLHAQESNRLTIRKSDVDAVVS 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes4NP_001163253.1 CBFD_NFYB_HMF 78..140 CDD:366318 25/61 (41%)
NF-YC5NP_199860.1 CBFD_NFYB_HMF 36..99 CDD:279185 25/62 (40%)
Periplasmic_Binding_Protein_Type_2 <111..>152 CDD:304360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1622159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.