DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes4 and NF-YC13

DIOPT Version :9

Sequence 1:NP_001163253.1 Gene:Mes4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_199139.1 Gene:NF-YC13 / 834343 AraportID:AT5G43250 Length:130 Species:Arabidopsis thaliana


Alignment Length:78 Identity:25/78 - (32%)
Similarity:46/78 - (58%) Gaps:8/78 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAIS 141
            :.|:.|::.|||||.|::..|:||:.::..:.|||:..|:.:|...||:.|:||:....:.:|:.
plant    11 EFPIGRVKKIMKLDKDINKINSEALHVITYSTELFLHFLAEKSAVVTAEKKRKTVNLDHLRIAVK 75

  Fly   142 --------AVDSL 146
                    .:|||
plant    76 RHQPTSDFLLDSL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes4NP_001163253.1 CBFD_NFYB_HMF 78..140 CDD:366318 21/61 (34%)
NF-YC13NP_199139.1 CBFD_NFYB_HMF 10..74 CDD:395650 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1622159at2759
OrthoFinder 1 1.000 - - FOG0005115
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.