DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PolE4 and AT5G19490

DIOPT Version :10

Sequence 1:NP_611669.1 Gene:PolE4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_197450.2 Gene:AT5G19490 / 832069 AraportID:AT5G19490 Length:264 Species:Arabidopsis thaliana


Alignment Length:74 Identity:21/74 - (28%)
Similarity:35/74 - (47%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TQLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAI 140
            |:.|..||:.||:.|.::.........:|:||:|||:..|...:|..|.....||:....:...:
plant     7 TRFPATRIKKIMQTDEEVGKIAMAVPLLVSKALELFLQDLCNHTYDVTLSRGAKTVNAFHLKQCV 71

  Fly   141 SAVDSLLFL 149
            .|.:...||
plant    72 QATNVFDFL 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PolE4NP_611669.1 HFD_POLE4-like 75..153 CDD:467054 21/74 (28%)
AT5G19490NP_197450.2 HFD_DRAP1 7..80 CDD:467031 19/72 (26%)

Return to query results.
Submit another query.