DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes4 and NF-YC1

DIOPT Version :9

Sequence 1:NP_001163253.1 Gene:Mes4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_190428.1 Gene:NF-YC1 / 824019 AraportID:AT3G48590 Length:234 Species:Arabidopsis thaliana


Alignment Length:79 Identity:36/79 - (45%)
Similarity:51/79 - (64%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NEAKMTQLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRD 135
            |:.|..|||||||:.|||.|.|:.|.:.||..:.|||.||||..|:..|:.:..::|::|:||.|
plant    59 NDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKND 123

  Fly   136 VDMAISAVDSLLFL 149
            :..||:..|...||
plant   124 IAAAITRTDIFDFL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes4NP_001163253.1 CBFD_NFYB_HMF 78..140 CDD:366318 28/61 (46%)
NF-YC1NP_190428.1 HAP5 <47..178 CDD:227533 36/79 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.