DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes4 and Pole4

DIOPT Version :9

Sequence 1:NP_001163253.1 Gene:Mes4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001357224.1 Gene:Pole4 / 66979 MGIID:1914229 Length:172 Species:Mus musculus


Alignment Length:127 Identity:48/127 - (37%)
Similarity:76/127 - (59%) Gaps:12/127 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AELAETEEPLEITEESPDNPEAESTTEQLTEKPVTNGNKAPADNEAKMTQLPLARIRNIMKLDPD 92
            |..|.:..|.|  ||:|....|.|..:..|..|          ...::::|||||::.::|.|||
Mouse     4 AAAAGSGTPRE--EEAPGGEAAASQAQAPTSAP----------GGVRLSRLPLARVKALVKADPD 56

  Fly    93 LHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAISAVDSLLFLDGAMN 154
            :.:|..||:||:|:|.|||:.::::::|....|.|:||:|:||:|.||.|||...||:|..|
Mouse    57 VTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGLFN 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes4NP_001163253.1 CBFD_NFYB_HMF 78..140 CDD:366318 28/61 (46%)
Pole4NP_001357224.1 HAP5 <38..>113 CDD:227533 33/74 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833722
Domainoid 1 1.000 72 1.000 Domainoid score I9343
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I5103
Isobase 1 0.950 - 0 Normalized mean entropy S1309
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005115
OrthoInspector 1 1.000 - - oto94321
orthoMCL 1 0.900 - - OOG6_106333
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 1 1.000 - - X6228
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.