DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PolE4 and Drap1

DIOPT Version :10

Sequence 1:NP_611669.1 Gene:PolE4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001278009.1 Gene:Drap1 / 66556 MGIID:1913806 Length:212 Species:Mus musculus


Alignment Length:82 Identity:21/82 - (25%)
Similarity:38/82 - (46%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PADNEAKMTQLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQ 132
            |:..:....:.|.|||:.||:.|.::.........|:::|:|||:.||.:::...|.....||:.
Mouse     2 PSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMT 66

  Fly   133 KRDVDMAISAVDSLLFL 149
            ...:...|.......||
Mouse    67 TSHLKQCIELEQQFDFL 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PolE4NP_611669.1 HFD_POLE4-like 75..153 CDD:467054 20/75 (27%)
Drap1NP_001278009.1 HFD_DRAP1 9..83 CDD:467031 18/73 (25%)

Return to query results.
Submit another query.