DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes4 and pole4

DIOPT Version :9

Sequence 1:NP_001163253.1 Gene:Mes4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_017213760.1 Gene:pole4 / 553610 ZFINID:ZDB-GENE-050522-309 Length:179 Species:Danio rerio


Alignment Length:129 Identity:48/129 - (37%)
Similarity:76/129 - (58%) Gaps:10/129 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TEEAELAETEEPLEITEESPDNPEAESTTEQLTEKPVTNGNKAP--ADNEAKMTQLPLARIRNIM 87
            |..|..||:|......||.|...|        .|:...:|...|  ...:.::.:|||:||:.:|
Zfish     4 TASAAPAESELDRSGAEEEPRGTE--------PEEDAGSGQTGPTAGAQQHRLARLPLSRIKTLM 60

  Fly    88 KLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAISAVDSLLFLDG 151
            |.|||:.:|:.|:|||:|||.|||:..:::::..|..|.|:||:|::|:|.||.|:|...||:|
Zfish    61 KADPDVTLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDEFAFLEG 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes4NP_001163253.1 CBFD_NFYB_HMF 78..140 CDD:366318 29/61 (48%)
pole4XP_017213760.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576441
Domainoid 1 1.000 74 1.000 Domainoid score I9153
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5085
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1622159at2759
OrthoFinder 1 1.000 - - FOG0005115
OrthoInspector 1 1.000 - - oto41697
orthoMCL 1 0.900 - - OOG6_106333
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 1 1.000 - - X6228
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.