DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes4 and pole4

DIOPT Version :9

Sequence 1:NP_001163253.1 Gene:Mes4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001016605.1 Gene:pole4 / 549359 XenbaseID:XB-GENE-5722002 Length:115 Species:Xenopus tropicalis


Alignment Length:131 Identity:48/131 - (36%)
Similarity:78/131 - (59%) Gaps:22/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ETEEAELAETEEPLEITEESPDNPEAESTTEQLTEKPVTNGNKAPADNEAKMTQLPLARIRNIMK 88
            |.|..|.:.::|     |..|.:|.|:                 ||....|..:|||:||:.:||
 Frog     7 EPESLEGSGSKE-----EGEPSSPSAQ-----------------PAPGPQKQARLPLSRIKALMK 49

  Fly    89 LDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAISAVDSLLFLDGAM 153
            .||||.:|:.|:||:::||.||||.::::::|.|..|.|:||:|::|:|.||.|:|...||:|.:
 Frog    50 ADPDLSLASQESVFVISKATELFIETIAKDAYLYAQQGKRKTLQRKDLDNAIDAIDEFAFLEGTL 114

  Fly   154 N 154
            :
 Frog   115 D 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes4NP_001163253.1 CBFD_NFYB_HMF 78..140 CDD:366318 30/61 (49%)
pole4NP_001016605.1 CBFD_NFYB_HMF 38..101 CDD:279185 30/62 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9116
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1622159at2759
OrthoFinder 1 1.000 - - FOG0005115
OrthoInspector 1 1.000 - - oto104533
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6228
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.