DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes4 and chrac1

DIOPT Version :9

Sequence 1:NP_001163253.1 Gene:Mes4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001013311.1 Gene:chrac1 / 503606 ZFINID:ZDB-GENE-050227-18 Length:114 Species:Danio rerio


Alignment Length:77 Identity:24/77 - (31%)
Similarity:40/77 - (51%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 AKMTQLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVD 137
            ::...||::|:|.|||..||:...|.:|:|:..||.|||:..|:..||.........|:...|:.
Zfish    11 SRTISLPISRVRLIMKSSPDVSCINQDALFLTTKATELFVQHLALSSYENGPSKDTNTLSYSDLA 75

  Fly   138 MAISAVDSLLFL 149
            ..:...::..||
Zfish    76 DTVEETETFQFL 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes4NP_001163253.1 CBFD_NFYB_HMF 78..140 CDD:366318 22/61 (36%)
chrac1NP_001013311.1 H4 15..75 CDD:304892 22/59 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1622159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.