DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes4 and Nf-YC

DIOPT Version :9

Sequence 1:NP_001163253.1 Gene:Mes4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster


Alignment Length:162 Identity:46/162 - (28%)
Similarity:71/162 - (43%) Gaps:24/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SEEQDLEHQQAMETEE----AELAE-----TEEPLEITEESPDNPEAESTTEQLTEKPVTNGNKA 67
            |..|..:.||..:.::    |.|..     ....:.:|..:.....|:..|.:.|...|......
  Fly    64 SSAQQQQQQQGQQQQQTVPMASLVSNACTLVNPSMSVTVATTVASGAKEKTTKATRTQVARKPPP 128

  Fly    68 PADN---------------EAKMTQLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELFIASLSR 117
            ..||               :||...||||||:.|||||.:..|...||..:.|||.|.||..|:.
  Fly   129 TIDNFWPNIVSEVHSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTM 193

  Fly   118 ESYTYTAQSKKKTIQKRDVDMAISAVDSLLFL 149
            .::.:|.:|:::|:|:.|:..||:..|...||
  Fly   194 HAWVHTEESRRRTLQRSDIAQAIANYDQFDFL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes4NP_001163253.1 CBFD_NFYB_HMF 78..140 CDD:366318 26/61 (43%)
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 35/96 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456666
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1622159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.