DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes4 and php5

DIOPT Version :9

Sequence 1:NP_001163253.1 Gene:Mes4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_596412.1 Gene:php5 / 2540133 PomBaseID:SPBC3B8.02 Length:415 Species:Schizosaccharomyces pombe


Alignment Length:131 Identity:38/131 - (29%)
Similarity:66/131 - (50%) Gaps:16/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EPLEITEESPDNP-EAESTTEQLTEKPVTNGNKAPA-------------DNEAKMTQLPLARIRN 85
            :|..:...:...| |..|..:.:|:..|.:..:|.|             |...|...||||||:.
pombe    52 DPTAVNHYNASAPIEVASPFDNVTQGLVGSDAQALAEYWQKTIDTLEHDDQAVKTLHLPLARIKK 116

  Fly    86 IMKLDPDL--HMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAISAVDSLLF 148
            :||.|.|:  .|.:.||.|:.||..|:|||.|:..::.:..:::::|:|:.|:..|:|..:...|
pombe   117 VMKTDDDVKNKMISAEAPFLFAKGSEIFIAELTMRAWLHAKKNQRRTLQRSDIANAVSKSEMYDF 181

  Fly   149 L 149
            |
pombe   182 L 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes4NP_001163253.1 CBFD_NFYB_HMF 78..140 CDD:366318 24/63 (38%)
php5NP_596412.1 HAP5 1..287 CDD:227533 38/131 (29%)
CBFD_NFYB_HMF 109..173 CDD:279185 24/63 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.