DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PolE4 and DRAP1

DIOPT Version :10

Sequence 1:NP_611669.1 Gene:PolE4 / 37560 FlyBaseID:FBgn0034726 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_006433.2 Gene:DRAP1 / 10589 HGNCID:3019 Length:205 Species:Homo sapiens


Alignment Length:82 Identity:21/82 - (25%)
Similarity:38/82 - (46%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PADNEAKMTQLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQ 132
            |:..:....:.|.|||:.||:.|.::.........|:::|:|||:.||.:::...|.....||:.
Human     2 PSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMT 66

  Fly   133 KRDVDMAISAVDSLLFL 149
            ...:...|.......||
Human    67 TSHLKQCIELEQQFDFL 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PolE4NP_611669.1 HFD_POLE4-like 75..153 CDD:467054 20/75 (27%)
DRAP1NP_006433.2 HFD_DRAP1 9..83 CDD:467031 18/73 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..205
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.