powered by:
Protein Alignment TRIM73 and Su(z)2
DIOPT Version :9
Sequence 1: | NP_944606.2 |
Gene: | TRIM73 / 375593 |
HGNCID: | 18162 |
Length: | 250 |
Species: | Homo sapiens |
Sequence 2: | NP_001260933.1 |
Gene: | Su(z)2 / 36432 |
FlyBaseID: | FBgn0265623 |
Length: | 1396 |
Species: | Drosophila melanogaster |
Alignment Length: | 49 |
Identity: | 14/49 - (28%) |
Similarity: | 23/49 - (46%) |
Gaps: | 4/49 - (8%) |
- Green bases have known domain annotations that are detailed below.
Human 9 ELEDRLQCPICLEVFKESLMLQ-CGHSYCKGCLVSLSYHLDTKVRCPMC 56
:..|.:.|.:|.....:...:. |.|:||:.|::. ||...|.||.|
Fly 28 QFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCILK---HLLRAVYCPEC 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.