DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRIM73 and Su(z)2

DIOPT Version :9

Sequence 1:NP_944606.2 Gene:TRIM73 / 375593 HGNCID:18162 Length:250 Species:Homo sapiens
Sequence 2:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster


Alignment Length:49 Identity:14/49 - (28%)
Similarity:23/49 - (46%) Gaps:4/49 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     9 ELEDRLQCPICLEVFKESLMLQ-CGHSYCKGCLVSLSYHLDTKVRCPMC 56
            :..|.:.|.:|.....:...:. |.|:||:.|::.   ||...|.||.|
  Fly    28 QFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCILK---HLLRAVYCPEC 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRIM73NP_944606.2 RING 15..60 CDD:238093 13/43 (30%)
BBOX 90..125 CDD:237988
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 12/40 (30%)
RAWUL 143..228 CDD:292824
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.