DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRIM73 and trim62.2

DIOPT Version :9

Sequence 1:NP_944606.2 Gene:TRIM73 / 375593 HGNCID:18162 Length:250 Species:Homo sapiens
Sequence 2:XP_021335576.1 Gene:trim62.2 / 100537628 ZFINID:ZDB-GENE-141216-17 Length:352 Species:Danio rerio


Alignment Length:111 Identity:23/111 - (20%)
Similarity:48/111 - (43%) Gaps:5/111 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   132 MKEELAALFSELKQEQKKVDELIAKLVKNRTRIVNESDVFSWVIRREFQELRHPVDEEKARCLEG 196
            |||:||.    |:..:|...|.:..|.:..|...:.:......|...|:.|:..:.|.:...||.
Zfish     1 MKEQLAT----LQDSEKGHTEALQLLQRQLTETKSSAKSLRATIGEAFERLQRFLRERQKSMLEE 61

Human   197 IGGHTRGLVASLDMQLEQ-AQGTRERLAQAECVLEQFGNEDHHEFI 241
            :...|...:..::.:::: :|..|:.....:.:.|:......|||:
Zfish    62 LEADTARTLTDIEHKIQRYSQQLRDVKEGIQILQERLSETSRHEFL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRIM73NP_944606.2 RING 15..60 CDD:238093
BBOX 90..125 CDD:237988
trim62.2XP_021335576.1 ClassIIa_HDAC_Gln-rich-N 1..107 CDD:330228 22/109 (20%)
SPRY 161..348 CDD:322017
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D158777at7742
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.880

Return to query results.
Submit another query.