DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and AT1G09660

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001320903.1 Gene:AT1G09660 / 837494 AraportID:AT1G09660 Length:298 Species:Arabidopsis thaliana


Alignment Length:255 Identity:68/255 - (26%)
Similarity:109/255 - (42%) Gaps:64/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QKFLADLDEERQRLS---ADFPLCALLIDEAVDRVYCTGRIPGKEFY------------------ 69
            :::|.:|.:|||:|.   ...|.|..|::..:.||   ...|..:.|                  
plant    43 ERYLTELLQERQKLGPFLQVMPNCCRLLNHEIRRV---SSFPDLDRYEHGSPFRSLGQPTNGKLD 104

  Fly    70 ------------ADVYKQKPMK-----------------ITQKVF---VPVKQYPKFNFTGKILG 102
                        ..:.:..|.:                 |.:||.   |||.:||.:||.|:|||
plant   105 LEGWSMMQAEENCHLQRASPFRGPSPVGWIGMPGLPNPPIVKKVIRLDVPVDKYPSYNFVGRILG 169

  Fly   103 PKGNSLRRLQEETQCKIAIKGRSSIRDRNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYAR 167
            |:||||:|::..|.|::.|:||.|::|..|||:|:  |.|.|.||.:.|.:.:..........:|
plant   170 PRGNSLKRVELATHCRVFIRGRGSVKDTVKEEKLK--GKPGYEHLCEPLHVLIEAELPEDIINSR 232

  Fly   168 IAYALAEIRKYLIP--DKNDEVSHEQLRELMEMD----PESAKNIHGPNLEAYRSVFDKK 221
            :.:|:..:...|.|  :..|....|||:||..::    .||......|.|....|.|:.|
plant   233 LEHAVHFLESLLKPMDESMDHYKREQLKELAALNGTLREESPSPSLSPCLSPSMSPFNSK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 46/127 (36%)
AT1G09660NP_001320903.1 STAR_dimer 45..90 CDD:406848 13/47 (28%)
KH-I 146..246 CDD:412160 39/101 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.