DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and AT3G08620

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_187474.2 Gene:AT3G08620 / 820009 AraportID:AT3G08620 Length:283 Species:Arabidopsis thaliana


Alignment Length:280 Identity:70/280 - (25%)
Similarity:121/280 - (43%) Gaps:72/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PTHDHQPRL----NEVAQKFLADLDEERQRLS---ADFPLCALLIDEAVDRVYCTGRIPGKEFYA 70
            |:....|::    ::|..::::.|..|.|:|.   ...|:|:.|:::.:.|:  ||.:|.:.| .
plant    12 PSRAASPQIRTPSSDVDSQYISQLLAEHQKLGPFMQVLPICSRLLNQEIFRI--TGMMPNQGF-T 73

  Fly    71 DVYKQK----------------------------------------------------PMKITQK 83
            |..:.:                                                    |:|...:
plant    74 DFDRLRHRSPSPMASPNLMSNVSGGGLGGWNGLPPERIGGPHGMAMEWQGAPASPSSYPVKRILR 138

  Fly    84 VFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRDRNKEEQLRSTGDPRYAHLQ 148
            :.:||..||.|||.|::|||:||||:|::..|.|::.|:|:.||:|..|||:|:  |.|.|.||.
plant   139 LDLPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPEKEEKLK--GKPGYEHLN 201

  Fly   149 KDL--FLEVSTVATPAECYARIAYALAEIRKYLIPDKNDEVSHEQLRELMEMDPESAKNIHGPNL 211
            :.|  .:|........:...|.|..:.|.....:.:..|.:..:|||||..::....:|..||: 
plant   202 EQLHILIEADLPIDIVDIKLRQAQEIIEELVKPVDESQDYIKRQQLRELALLNSNLRENSPGPS- 265

  Fly   212 EAYRSVFDKKFGGNSNGAPK 231
               .||  ..|..|:...||
plant   266 ---GSV--SPFNSNAMKRPK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 43/120 (36%)
AT3G08620NP_187474.2 STAR_dimer 28..74 CDD:406848 12/48 (25%)
KH-I 134..234 CDD:412160 38/101 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.