DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and AT2G38610

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_181395.1 Gene:AT2G38610 / 818443 AraportID:AT2G38610 Length:286 Species:Arabidopsis thaliana


Alignment Length:281 Identity:70/281 - (24%)
Similarity:121/281 - (43%) Gaps:72/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PTHDHQPRLNEV----AQKFLADLDEERQRLS---ADFPLCALLIDEAVDRVYCTGRIPGKEF-- 68
            |.....|::...    :.::|.:|..|.|:|:   ...|:|:.|:::.:.||  :|.:..:.|  
plant    13 PARAASPQIRSTPEIDSSQYLTELLAEHQKLTPFMQVLPICSRLLNQEMFRV--SGMMSNQGFGD 75

  Fly    69 YADVYKQKP-------------------------------------------------MKITQKV 84
            :..:..:.|                                                 :|...::
plant    76 FDRLRHRSPSPMASSNLMSNVSNTGLGGWNGLSQERLSGTPGMTMDWQGAPGSPSSYTVKRILRL 140

  Fly    85 FVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRDRNKEEQLRSTGDPRYAHLQK 149
            .:||..||.|||.|::|||:||||:|::..|.|::.|:|:.||:|..||::||  |.|.|.||.:
plant   141 EIPVDNYPNFNFVGRLLGPRGNSLKRVEATTGCRVFIRGKGSIKDPEKEDKLR--GRPGYEHLNE 203

  Fly   150 DL--FLEVSTVATPAECYARIAYALAEIRKYLIPDKNDEVSHEQLRELMEMDPESAK-NIHGPNL 211
            .|  .:|....|:..|...|.|..:.|.....:.:..|.:..:|||||..::..:.: ...||:.
plant   204 QLHILIEADLPASIVEIRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNNLREESPGPSG 268

  Fly   212 EAYRSVFDKKFGGNSNG-APK 231
            ....|.|      ||:| .||
plant   269 GGSVSPF------NSSGKRPK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 45/120 (38%)
AT2G38610NP_181395.1 STAR_dimer 29..75 CDD:406848 12/47 (26%)
KH-I 135..235 CDD:412160 40/101 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.