DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and khdrbs2

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001070758.1 Gene:khdrbs2 / 768147 ZFINID:ZDB-GENE-061013-497 Length:346 Species:Danio rerio


Alignment Length:280 Identity:96/280 - (34%)
Similarity:145/280 - (51%) Gaps:59/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KFLADLDEERQRLSADFPLCALLIDEAVDRVYCTGRIPGKEF--------YADVYKQKPMKITQK 83
            |:|.:|..|::.|.|.|.....|:.|.::      :..|.|.        |.|:...|.:|::::
Zfish     5 KYLPELVAEKESLDASFVHAMRLLAEEIE------KFEGDELRKDGEVKKYLDIISNKNIKLSER 63

  Fly    84 VFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRDRNKEEQLRSTGDPRYAHLQ 148
            |.:||:|||||||.||:|||:|||::||||||..|::|.|:.|:||:.|||:||.:|:.:||||.
Zfish    64 VLIPVQQYPKFNFVGKLLGPRGNSMKRLQEETGAKMSILGKGSMRDKGKEEELRKSGEAKYAHLS 128

  Fly   149 KDLFLEVSTVATPAECYARIAYALAEIRKYLIPDKNDEVSHEQLRELMEM----DPESAKNIHGP 209
            .||.:.:...|.|.|.|:|:::||.||:|:|:||.|||:..||||||..:    ||...::..|.
Zfish   129 NDLHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSDDPSRGRSARGR 193

  Fly   210 NLEAYRSVFDKKFGGNSNGAPKYINLIKRAAENPPEVDDVEEVAYEYEHRMPPKRPPTGYEYSKP 274
            .|..           .|..:|:     .|.:..||                    .|.|...:.|
Zfish   194 GLRL-----------TSTASPR-----GRGSAAPP--------------------APPGRGAAAP 222

  Fly   275 RPSI-----IPTNAAAYKRP 289
            |.::     :||.|.....|
Zfish   223 RGTVSSRTSVPTPARGVSAP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 64/122 (52%)
khdrbs2NP_001070758.1 Qua1 6..57 CDD:292891 12/56 (21%)
SF1_like-KH 61..180 CDD:239088 64/118 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..292 18/104 (17%)
Sam68-YY <281..>306 CDD:293176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590099
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.