DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and SF1

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001365886.1 Gene:SF1 / 7536 HGNCID:12950 Length:764 Species:Homo sapiens


Alignment Length:350 Identity:83/350 - (23%)
Similarity:134/350 - (38%) Gaps:89/350 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSEFTEKQPPTHDHQ-PRLNEVAQKFLADLDEERQRLSADFPLCALLIDEAVDRVYCTGRIPGKE 67
            |.:.:....|.::.: .|||....:....|:|||..          ||.|.|      ...|..:
Human   201 PEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHN----------LITEMV------ALNPDFK 249

  Fly    68 FYADVYKQKPMKITQKVFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRD--- 129
            ..|| ||....:::.||.:|..:||:.||.|.::||:||:|:.:::|...||.|:|:.|:::   
Human   250 PPAD-YKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKV 313

  Fly   130 -RNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYL-----IPDKNDEVS 188
             |...:.|....:|.:|             ...|.....:..|:.:||..|     .|:..:::.
Human   314 GRKDGQMLPGEDEPLHA-------------LVTANTMENVKKAVEQIRNILKQGIETPEDQNDLR 365

  Fly   189 HEQLRELMEMD---PESAKNIHGP-NLEAYRSVFD----KKFGGNSN----------GAP----- 230
            ..|||||..::   .|....|..| .....||:.:    .|.||..:          |.|     
Human   366 KMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQD 430

  Fly   231 ------KYINLIKRAAENPPEVDDVEEVAYEYEHRMPPKRPPTGYEYSKPRPSIIPTNAAAYKRP 289
                  :|::|:....|.|        |.........|...|..   |.|||:     |.|...|
Human   431 KARMDKEYLSLMAELGEAP--------VPASVGSTSGPATTPLA---SAPRPA-----APANNPP 479

  Fly   290 YPTDMKRMR-EPPIKSYKPN---PY 310
            .|:.|...: .||..:..|:   ||
Human   480 PPSLMSTTQSRPPWMNSGPSESRPY 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 34/130 (26%)
SF1NP_001365886.1 MSL5 142..382 CDD:227503 52/210 (25%)
ZnF_C2HC 403..418 CDD:197667 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.