DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and sf1

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_009301350.1 Gene:sf1 / 572785 ZFINID:ZDB-GENE-030131-2492 Length:663 Species:Danio rerio


Alignment Length:378 Identity:87/378 - (23%)
Similarity:134/378 - (35%) Gaps:122/378 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSEFTEKQPPTHDHQ-PRLNEVAQKFLADLDEERQRLSADFPLCALLIDEAVDRVYCTGRIPGKE 67
            |.:.:....|.::.: .|||....:....|:|||..          ||.|.|      |..|..:
Zfish   148 PEDRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHS----------LITEMV------GLNPEFK 196

  Fly    68 FYADVYKQKPMKITQKVFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRD--- 129
            ..|| ||....:::.||.:|..:||:.||.|.::||:||:|:.:::|...||.|:|:.|:::   
Zfish   197 PPAD-YKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKV 260

  Fly   130 -RNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYL-----IPDKNDEVS 188
             |...:.|....:|.:|             ...|.....:..|:.:||..|     .|:..:::.
Zfish   261 GRKDGQMLPGEDEPLHA-------------LVTANTMENVKKAVEQIRNILKQGIETPEDQNDLR 312

  Fly   189 HEQLRELMEM------------------DPESAKNIHGPNLEAYRSVFDKKFGG----------N 225
            ..|||||..:                  :|.|..|          :....|.||          .
Zfish   313 KMQLRELARLNGTLREDDNRILRPWQSTEPRSITN----------TTLCTKCGGAGHISSDCKFT 367

  Fly   226 SNGAPKYINLIKRAAENPPEVDDVEEVAYEY--------EHRMPP------KRPPTGYEYSKPRP 276
            |:.||       |..|.|....|...:..||        |..:|.      ..||:|...|.|..
Zfish   368 SSFAP-------RPGEPPQSAQDKARMDKEYLSLMAELGEAPVPSSGGGHNNAPPSGPRPSGPNN 425

  Fly   277 SIIPTNAAAYKRPYPTD--------------------MKRMREPPIKSYKPNP 309
            :..|.|...:....|||                    |..|..||:   .|||
Zfish   426 NQPPPNRPPWMNSGPTDNRNFHGMHQGPGGPHNFPPPMPNMGGPPM---PPNP 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 34/145 (23%)
sf1XP_009301350.1 SF1-HH 90..202 CDD:292892 17/70 (24%)
SF1_like-KH 209..327 CDD:239088 34/130 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.