DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and SF1

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_524654.2 Gene:SF1 / 43912 FlyBaseID:FBgn0025571 Length:787 Species:Drosophila melanogaster


Alignment Length:366 Identity:75/366 - (20%)
Similarity:138/366 - (37%) Gaps:123/366 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ETPSEFTEKQPPTHDHQ-PRLNEVAQKFLADLDEERQRLSADFPLCALLIDEAVDRVYCTGRIPG 65
            :.|.|.:....|.:... .|||....::...|:|:|.:|....                  :...
  Fly   329 QNPEERSPSPEPIYSSDGKRLNTREFRYRKRLEEQRHQLIVKM------------------QTVN 375

  Fly    66 KEFY--ADVYKQKPMKITQKVFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIR 128
            .||.  || ||....:::.||.:|.:|:|..||.|.::||:||:|:.::::|..||.|:|:.|::
  Fly   376 PEFKPPAD-YKPPVTRVSDKVLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIRGKGSVK 439

  Fly   129 D----RNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYL-----IPDKN 184
            :    |...:.|....:|.:|.:         |...|    ..:..|:.:|:..:     :|:.:
  Fly   440 EGKVGRKDGQPLPGEDEPLHAFI---------TAPNP----EAVRKAVDKIKDVIRQGIEVPEGH 491

  Fly   185 DEVSHEQLRELMEMDPESAKNIHGPNLEAYRSVF-----------DKKF----------GGN--- 225
            :::...|||||.:::....:|      :..|...           ||..          ||.   
  Fly   492 NDLRRMQLRELAQLNGTLREN------DIQRCTCGSTDHKSWQCPDKPIITNTIVCTSCGGTGHL 550

  Fly   226 ---------SNGAP-------------KYINLIKRAAENPPEVDDVEEVAYEYEHRMPPKRPPTG 268
                     .:|.|             :|::|:....|.||                    ||:.
  Fly   551 TKDCRNKRPGSGVPGMACEDSQAKIDEEYMSLMAELGEGPP--------------------PPSA 595

  Fly   269 YEYSKPRPSIIP-TNAAAY----KRPYPTDMKRMREPPIKS 304
            ...:.|..|..| .:.|:|    |:  |:.|:.::.||..|
  Fly   596 SAKTDPPASNGPQLHRASYSIFDKK--PSQMQAIQSPPSSS 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 33/127 (26%)
SF1NP_524654.2 MSL5 253..512 CDD:227503 49/214 (23%)
SF1-HH 274..385 CDD:292892 14/74 (19%)
SF1_like-KH 392..510 CDD:239088 33/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460730
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.